PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G31180.1
Common NameATMYB14, MYB14, MYB14AT
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 249aa    MW: 28769.1 Da    PI: 5.6815
Description myb domain protein 14
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G31180.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l+++++++G  +W++ +++ g+ R++k+c++rw +yl
      AT2G31180.1 14 RGPWTPEEDQILINYIHLYGHSNWRALPKHAGLLRCGKSCRLRWINYL 61
                     89******************************99************97 PP

2Myb_DNA-binding52.11.5e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E++ ++++++ lG++ W++Ia++++ gRt++++k+ w+++l
      AT2G31180.1  67 RGNFTPQEEQTIINLHESLGNR-WSAIAAKLP-GRTDNEIKNVWHTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-26564IPR009057Homeodomain-like
PROSITE profilePS5129417.588961IPR017930Myb domain
SuperFamilySSF466898.81E-3110108IPR009057Homeodomain-like
SMARTSM007171.7E-151363IPR001005SANT/Myb domain
PfamPF002492.2E-171461IPR001005SANT/Myb domain
CDDcd001677.43E-121661No hitNo description
PROSITE profilePS5129424.8762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-2765116IPR009057Homeodomain-like
SMARTSM007173.2E-1466114IPR001005SANT/Myb domain
PfamPF002492.6E-1567112IPR001005SANT/Myb domain
CDDcd001671.07E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000084anatomyplant sperm cell
PO:0009005anatomyroot
PO:0020100anatomyhypocotyl
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MGRAPCCEKM GVKRGPWTPE EDQILINYIH LYGHSNWRAL PKHAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TPQEEQTIIN LHESLGNRWS AIAAKLPGRT DNEIKNVWHT HLKKRLSKNL  120
NNGGDTKDVN GINETTNEDK GSVIVDTASL QQFSNSITTF DISNDNKDDI MSYEDISALI  180
DDSFWSDVIS VDNSNKNEKK IEDWEGLIDR NSKKCSYSNS KLYNDDMEFW FDVFTSNRRI  240
EEFSDIPEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27141167108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible266469_at0.0
Expression AtlasAT2G31180-
AtGenExpressAT2G31180-
ATTED-IIAT2G31180-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G31180.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin, ethylene, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G31180
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195750.0AY519575.1 Arabidopsis thaliana MYB transcription factor (At2g31180) mRNA, complete cds.
GenBankBT0248530.0BT024853.1 Arabidopsis thaliana At2g31180 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_180676.10.0myb domain protein 14
SwissprotQ7XBH43e-75MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLQ9SJX80.0Q9SJX8_ARATH; At2g31180
STRINGAT2G31180.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Hoth S, et al.
    Monitoring genome-wide changes in gene expression in response to endogenous cytokinin reveals targets in Arabidopsis thaliana.
    FEBS Lett., 2003. 554(3): p. 373-80
    [PMID:14623097]
  4. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  5. AbuQamar S, et al.
    Expression profiling and mutant analysis reveals complex regulatory networks involved in Arabidopsis response to Botrytis infection.
    Plant J., 2006. 48(1): p. 28-44
    [PMID:16925600]
  6. Osuna D, et al.
    Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings.
    Plant J., 2007. 49(3): p. 463-91
    [PMID:17217462]
  7. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]